PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco016777.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family TALE
Protein Properties Length: 666aa    MW: 71567.6 Da    PI: 7.5786
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco016777.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.23.3e-093513881954
                  HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
     Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                  Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  Aco016777.1 351 FEHflHPYPKDSDKLMLAKQTGLTRSQVSNWFINARVR 388
                  664459******************************88 PP

2BELL122.22.1e-39218289172
         BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                  e+qelq+kkakL+++l+eV++rY+qy++q+q+vissFeavag gsa+ Yt+lAl++iS++FrcL+dai++qi
  Aco016777.1 218 EKQELQMKKAKLVNMLDEVEQRYRQYHHQMQIVISSFEAVAGRGSARTYTALALQTISKQFRCLRDAITGQI 289
                  689********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005749.7E-58142287IPR006563POX domain
PfamPF075262.7E-50148286IPR006563POX domain
PROSITE profilePS5007112.115329392IPR001356Homeobox domain
CDDcd000861.87E-12332393No hitNo description
SMARTSM003892.7E-9332396IPR001356Homeobox domain
SuperFamilySSF466895.13E-17333399IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.6E-28335398IPR009057Homeodomain-like
PfamPF059206.0E-18349388IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 666 aa     Download sequence    Send to blast
MATYFHGGPD IQTDSLQTLY LMNPAYVGYS DASAAAAAPA NMVLFNPAVN PMNPMSFAYS  60
PAAAGQEPIR SPHPPPPTIG ASPHDVSAVH GLVPGRVQYN LWTQPPPPTH QQGLSLSLSS  120
REMSVSAAEA TPNSGAPNAT AAAAQSFLMG SKYLKAAQQL LDEMVNVGKG GRAAHDAAAG  180
KGKSEDSDGG AEAGAVSGGG GQEEASAKRA AAELSTAEKQ ELQMKKAKLV NMLDEVEQRY  240
RQYHHQMQIV ISSFEAVAGR GSARTYTALA LQTISKQFRC LRDAITGQIR ATSKSLGEEN  300
AKTVGSRLRF VDHHLRQQRA LQQLGMMQHN AWRPQRGLPE RSVSILRAWL FEHFLHPYPK  360
DSDKLMLAKQ TGLTRSQVSN WFINARVRLW KPMVEEMYLE ETKDHEQINN NNNNNNSNNS  420
NSNTETGVEN NSAENEPDAA PTARQETDAP KSARRGGGFK EKQSSAVPSY YDDDLSMRQQ  480
PKLKKLRSDE PVHAAIASSS HSIAGVDTKP NEMNNRALLM KFIESSGRSI GEEQSYHSLI  540
AGATSNGGGG GGGGGGYGAY SMGEMGRFDS QNFAPRYSNN GVSLTLGLPH CENLSLSGGA  600
HSSFLPSEGM PFGRRIEMSG NEAGEFCSIG NSSQAVNSPQ PPNAYDINIQ SRKRFAAQLM  660
PDFVS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A1e-16338395158Homeobox protein Meis1
4xrs_B1e-16338395158Homeobox protein Meis1
5bng_A2e-16338396159Homeobox protein Meis2
5bng_B2e-16338396159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM6663480.0KM666348.1 Ananas bracteatus clone 51639b microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009420594.10.0PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 1
TrEMBLM0T8160.0M0T816_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr6P18180_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP48163758
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.33e-94BEL1-like homeodomain 1